Pfam domain
Pfam family: Ribosomal_L2 (PF00181.22)
Uniprot AC: A0QSD4
RecName: 50S ribosomal protein L2
Begin-End: 42-119
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
GRNAHGRITTRHKGGGHKRAYRVIDFRRHDKDGVNAKVAHIEYDPNRTANIALLHYLDGE
KRYIIAPQGLKQGDVIES
Structures of the domain A0QSD4 42-119
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xym X-ray 3.08 C 42-119 None
5o60 X-ray 3.2 C 42-119 None


© NPIDB team 2003 - 2019

text