Pfam domain
Pfam family: Ribosomal_S19 (PF00203.20)
Uniprot AC: A0QSD5
RecName: 30S ribosomal protein S19
Begin-End: 3-83
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
RSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFAVHDGRKHVPVFV
TEAMVGHKLGEFAPTRTFKGH
Structures of the domain A0QSD5 3-83
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyu X-ray 3.45 S 4-81 None
5o5j X-ray 3.45 S 3-83 None


© NPIDB team 2003 - 2019

text