Pfam domain
Pfam family: Ribosomal_L22 (PF00237.18)
Uniprot AC: A0QSD6
RecName: 50S ribosomal protein L22
Begin-End: 12-115
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
AKARYVRVSATKARRVIDLVRGKSVEEALDILRWAPQAASEPVAKVIASAAANAQNNEGL
DPSTLVVATVYADEGPTAKRIRPRAQGRAFRIRKRTSHITVIVE
Structures of the domain A0QSD6 12-115
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xym X-ray 3.08 S 12-114 None
5o60 X-ray 3.2 T 12-114 None


© NPIDB team 2003 - 2019

text