Pfam domain
Pfam family: Ribosomal_S3_C (PF00189.19)
Uniprot AC: A0QSD7
RecName: 30S ribosomal protein S3
Begin-End: 119-202
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
VAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTL
RADIDYGLYEAKTTFGRIGVKVWI
Structures of the domain A0QSD7 119-202
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyu X-ray 3.45 C 119-202 None
5o5j X-ray 3.45 C 119-202 None


© NPIDB team 2003 - 2019

text