Pfam domain
Pfam family: Ribosomal_L16 (PF00252.17)
Uniprot AC: A0QSD8
RecName: 50S ribosomal protein L16
Begin-End: 4-132
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
PRKVKHRKQHHPEQRGIASGGTSVSFGDYGIQALEHAYITNRQIESARIAINRHIKRGGK
VWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLFELSYPDEKTARDALTRAIH
KLPIKARIV
Structures of the domain A0QSD8 4-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dzp X-ray 3.42 N 4-132 None
5o60 X-ray 3.2 N 4-132 None
5xym X-ray 3.08 M 4-132 None
5zet X-ray 3.2 N 4-132 None


© NPIDB team 2003 - 2021

text