Pfam domain
Pfam family: Ribosomal_S17 (PF00366.19)
Uniprot AC: A0QSE0
RecName: 30S ribosomal protein S17
Begin-End: 25-92
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
GYVVSDKMQKTIVVELEDRKSHPLYGKIIRTTKKVKAHDENGEAGIGDRVSLMETRPLSA
TKRWRLVE
Structures of the domain A0QSE0 25-92
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyu X-ray 3.45 Q 25-92 None
5o5j X-ray 3.45 Q 25-92 None


© NPIDB team 2003 - 2019

text