Pfam domain
Pfam family: Ribosomal_L14 (PF00238.18)
Uniprot AC: A0QSF9
RecName: 50S ribosomal protein L14
Begin-End: 1-122
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGGNVKRGDVVKA
VVVRTVKERRRADGSYIKFDENAAVIIKNDNDPRGTRIFGPVGRELREKKFMKIVSLAPE
VL
Structures of the domain A0QSF9 1-122
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dzp X-ray 3.42 L 1-122 None
5o60 X-ray 3.2 L 1-122 None
5xym X-ray 3.08 K 1-122 None
5zet X-ray 3.2 L 1-121 None


© NPIDB team 2003 - 2021

text