Pfam domain
Pfam family: ribosomal_L24 (PF17136.3)
Uniprot AC: A0QSG0
RecName: 50S ribosomal protein L24
Begin-End: 38-105
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
VNRIKKHTAVSANERGASSGGIVTQEAPIHVSNVMVVDSDGKPTRVGYRIDDETGKKVRI
AKTNGKDI
Structures of the domain A0QSG0 38-105
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xym X-ray 3.08 U 61-105 None
5o60 X-ray 3.2 V 38-105 None


© NPIDB team 2003 - 2019

text