Pfam domain
Pfam family: Ribosomal_L5 (PF00281.18)
Uniprot AC: A0QSG1
RecName: 50S ribosomal protein L5
Begin-End: 31-87
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
NVMQIPGVVKVVVNMGVGDAARDAKLINGAINDLALITGQKPEVRRARKSIAQFKLR
Structures of the domain A0QSG1 31-87
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dzp X-ray 3.42 F 26-87 None
5o60 X-ray 3.2 F 31-87 None
5xym X-ray 3.08 F 31-87 None
5zet X-ray 3.2 F 31-87 None


© NPIDB team 2003 - 2021

text