Pfam domain
Pfam family: Ribosomal_S14 (PF00253.20)
Uniprot AC: A0QSG2
RecName: 30S ribosomal protein S14 type Z
Begin-End: 9-60
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
KANKKPKFAVRAYTRCNKCGRPHSVYRKFGLCRICLREMAHAGELPGVQKSS
Structures of the domain A0QSG2 9-60
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyu X-ray 3.45 N 9-60 None
5o5j X-ray 3.45 N 9-60 None


© NPIDB team 2003 - 2019

text