Pfam domain
Pfam family: Ribosomal_S8 (PF00410.18)
Uniprot AC: A0QSG3
RecName: 30S ribosomal protein S8
Begin-End: 5-132
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
DPIADFLTRLRNANSAYHDEVTLPHSKLKANIAEILKREGYISDYRTEDARVGKSLVVQL
KYGPSRERSIAGLRRVSKPGLRVYAKSTNLPRVLGGLGVAIISTSSGLLTDRQAARQGVG
GEVLAYVW
Structures of the domain A0QSG3 5-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyu X-ray 3.45 H 5-132 None
5o5j X-ray 3.45 H 5-132 None


© NPIDB team 2003 - 2019

text