Pfam domain
Pfam family: Ribosomal_L6 (PF00347.22)
Uniprot AC: A0QSG4
RecName: 50S ribosomal protein L6
Begin-End: 91-166
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
FGVGYRVQLKGQNLEFALGYSHPVLIEAPEGITFAVESPTKFSVSGIDKQKVGQISAVIR
RLRRPDPYKGKGVRYE
Structures of the domain A0QSG4 91-166
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xym X-ray 3.08 G 91-165 None
5o60 X-ray 3.2 G 91-165 None


© NPIDB team 2003 - 2019

text