Pfam domain
Pfam family: Ribosomal_L18p (PF00861.21)
Uniprot AC: A0QSG5
RecName: 50S ribosomal protein L18
Begin-End: 12-127
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
EVRRNARLRRHARLRKKVAGTAEVPRLVVNRSARHIHVQLVNDLNGTTLAAASSIEADVR
AIDGDKKAHSVRVGQLIAERAKAAGVETVVFDRGGYTYGGRIAALADAAREAGLKF
Structures of the domain A0QSG5 12-127
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o60 X-ray 3.2 P 14-127 None
5xym X-ray 3.08 O 14-127 None
5zet X-ray 3.2 P 14-127 None


© NPIDB team 2003 - 2021

text