Pfam domain
Pfam family: Ribosomal_S5 (PF00333.19)
Uniprot AC: A0QSG6
RecName: 30S ribosomal protein S5
Begin-End: 36-100
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
YIERVVSINRVSKVVKGGRRFSFTALVIVGDGKGMVGVGYGKAKEVPAAIAKGVEEARKN
FFRVP
Structures of the domain A0QSG6 36-100
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyu X-ray 3.45 E 38-100 None
5o5j X-ray 3.45 E 38-100 None


© NPIDB team 2003 - 2019

text