Pfam domain
Pfam family: Ribosomal_L27A (PF00828.18)
Uniprot AC: A0QSG8
RecName: 50S ribosomal protein L15
Begin-End: 29-146
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
KGKTAGRGTKGTKARKNVPVMFEGGQMPIHMRLPKLKGFKNRFRTEYQVVNVGDINKAFP
QGGTVGVDELVAKGLVRKNSLVKVLGDGKLTVKVDVTANKFSGSAREAITAAGGSATE
Structures of the domain A0QSG8 29-146
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dzp X-ray 3.42 M 29-145 None
5o60 X-ray 3.2 M 29-145 None
5xym X-ray 3.08 L 29-145 None
5zet X-ray 3.2 M 29-145 None


© NPIDB team 2003 - 2021

text