Pfam domain
Pfam family: Ribosomal_L36 (PF00444.17)
Uniprot AC: A0QSL4
RecName: 50S ribosomal protein L36
Begin-End: 1-37
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
MKVNPSVKPICDKCRVIRRHGRVMVICSDPRHKQRQG
Structures of the domain A0QSL4 1-37
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dzp X-ray 3.42 f 1-37 None
5o60 X-ray 3.2 f 6-42 None
5xym X-ray 3.08 4 1-37 None
5zet X-ray 3.2 7 1-37 None


© NPIDB team 2003 - 2021

text