Pfam domain
Pfam family: Ribosomal_S13 (PF00416.21)
Uniprot AC: A0QSL5
RecName: 30S ribosomal protein S13
Begin-End: 3-109
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
RLVGVDLPRDKRMEIALTYIYGIGRTRSNEILAATGIDKNMRTKDLTDDQVTVLRDYIEG
NLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNART
Structures of the domain A0QSL5 3-109
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyu X-ray 3.45 M 3-109 None
5o5j X-ray 3.45 M 3-109 None


© NPIDB team 2003 - 2019

text