Pfam domain
Pfam family: Ribosomal_S11 (PF00411.18)
Uniprot AC: A0QSL6
RecName: 30S ribosomal protein S11
Begin-End: 28-137
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
GAAHIKSTFNNTIVSITDPQGNVIAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHG
VKKVDVFVKGPGSGRETAIRSLQAAGLEVGTISDVTPQPHNGCRPPKRRR
Structures of the domain A0QSL6 28-137
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyu X-ray 3.45 K 28-137 None
5o5j X-ray 3.45 K 28-137 None


© NPIDB team 2003 - 2019

text