Pfam domain
Pfam family: Ribosomal_S4 (PF00163.18)
Uniprot AC: A0QSL7
RecName: 30S ribosomal protein S4
Begin-End: 3-90
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
RYTGPATRKSRRLGVDLVGGDQSFEKRPYPPGQHGRARIKESEYRQQLQEKQKARFSYGV
MEKQFRRYYEEANRQPGKTGDNLLRILE
Structures of the domain A0QSL7 3-90
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyu X-ray 3.45 D 12-90 None
5o5j X-ray 3.45 D 3-90 None


© NPIDB team 2003 - 2019

text