Pfam domain
Pfam family: S4 (PF01479.24)
Uniprot AC: A0QSL7
RecName: 30S ribosomal protein S4
Begin-End: 91-138
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
SRLDNVVYRAGLARTRRMARQLVSHGHFLVNGVKVDIPSYRVSQYDII
Structures of the domain A0QSL7 91-138
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyu X-ray 3.45 D 92-137 None
5o5j X-ray 3.45 D 92-137 None


© NPIDB team 2003 - 2019

text