Pfam domain
Pfam family: RNA_pol_A_CTD (PF03118.14)
Uniprot AC: A0QSL8
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 251-303
Organism: Mycobacterium smegmatis
Interaction Mode:  H-Bb L-Bb 

Sequence:
IDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQ
Structures of the domain A0QSL8 251-303
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5tw1 X-ray 2.76 T 251-302  H-Bb L-Bb 


© NPIDB team 2003 - 2019

text