Pfam domain
Pfam family: RNA_pol_A_bac (PF01000.25)
Uniprot AC: A0QSL8
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 52-152
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
TSIRIDGVLHEFTTVPGVKEDVTDIILNLKGLVVSSDDDEPVTMYLRKQGPGVVTAGDIV
PPAGVTVHNPDMHIATLNDKGKLEVELVVERGRGYVPAVQN
Structures of the domain A0QSL8 52-152
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5tw1 X-ray 2.76 A 57-149 None
5tw1 X-ray 2.76 B 57-149 None
5vi5 X-ray 3.2 B 57-149 None
5vi5 X-ray 3.2 A 57-149 None


© NPIDB team 2003 - 2019

text