Pfam domain
Pfam family: Ribosomal_L17 (PF01196.18)
Uniprot AC: A0QSL9
RecName: 50S ribosomal protein L17
Begin-End: 20-116
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
LLANLATSLFEHGRIKTTEPKARALRPYAEKLITHAKKGALHNRREVMKKIRDKDVVHTL
FAEIGPFYADRNGGYTRIIKVENRKGDNAPMAVIELV
Structures of the domain A0QSL9 20-116
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xym X-ray 3.08 N 20-116 None
5o60 X-ray 3.2 O 20-116 None


© NPIDB team 2003 - 2020

text