Pfam domain
Pfam family: Ribosomal_L13 (PF00572.17)
Uniprot AC: A0QSP8
RecName: 50S ribosomal protein L13
Begin-End: 13-131
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
RSWYVIDASDVVLGRLASAAATLLRGKHKPTFTPNVDGGDFVIVINADKIAVSGDKLTKK
FAYRHSGYPGGLRKRTIGELLEKHPTRVVENAIIGMLPHNKLGRQIQKKLKVYAGPDHP
Structures of the domain A0QSP8 13-131
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dzp X-ray 3.42 K 15-137 None
5o60 X-ray 3.2 K 15-137 None
5xym X-ray 3.08 J 15-137 None
5zet X-ray 3.2 K 15-137 None


© NPIDB team 2003 - 2021

text