Pfam domain
Pfam family: Ribosomal_S9 (PF00380.18)
Uniprot AC: A0QSP9
RecName: 30S ribosomal protein S9
Begin-End: 30-150
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
GRRKEAVVRVRLVPGTGQFNLDGRTLENYFPNKVHQQLIKAPLVTVDRVDQFDIYAHLDG
GGPSGQAGALRLAIARALILVQPEDRPALKKAGFLTRDPRAIERKKYGLKKARKAPQYSK
R
Structures of the domain A0QSP9 30-150
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyu X-ray 3.45 I 30-148 None
5o5j X-ray 3.45 I 30-150 None


© NPIDB team 2003 - 2019

text