Pfam domain
Pfam family: PDDEXK_1 (PF12705.9)
Uniprot AC: A0QTR9
RecName: DNA helicase
Begin-End: 795-1037
Organism: Mycolicibacterium smegmatis
Interaction Mode:   

Sequence:
TLSPSTLQMLTDCPLRWLLERHGGDDGRDVRSTVGSLVHALVSEPGKTESQLVNELEKVW
DDLPYDAKWYSDNELARHRAMLETFTRWREDTRRQLTEVATEIPVEGIVVEPGENTPGVR
VRGRLDRLERDEAGRLVVVDLKTGKSPVTKDDAQNHAQLAMYQLAVAAGLLDDGDEPGGG
KLVYLGKAGAAGATEREQDPLTPDKRAEWLETVGEAAAATAGPRFVARVNNGCANCPVRS
SCP
Structures of the domain A0QTR9 795-1037
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ppu X-ray 3.5 A 795-1037  L-Bb L-Mj 
6ppr X-ray 3.5 A 795-1037  H-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2021

text