Pfam domain
Pfam family: Ribosomal_L28 (PF00830.18)
Uniprot AC: A0QV03
RecName: 50S ribosomal protein L28
Begin-End: 3-61
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
AVCDICGKGPGFGKSVSHSHRRTSRRWNPNIQPVRAVTRPGGNKQRINACTSCIKAGKV
Structures of the domain A0QV03 3-61
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o60 X-ray 3.2 Y 4-60 None
5xym X-ray 3.08 X 4-60 None
5zet X-ray 3.2 Y 4-60 None


© NPIDB team 2003 - 2021

text