Pfam domain
Pfam family: Ribosomal_S16 (PF00886.18)
Uniprot AC: A0QV37
RecName: 30S ribosomal protein S16
Begin-End: 9-67
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
RLGKIRNPQYRIIVADARTRRDGRAIEVIGRYHPKEEPSLIQIDSERAQYWLGVGAQPT
Structures of the domain A0QV37 9-67
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyu X-ray 3.45 P 9-67 None
5o5j X-ray 3.45 P 9-67 None


© NPIDB team 2003 - 2019

text