Pfam domain
Pfam family: Ribosomal_L19 (PF01245.19)
Uniprot AC: A0QV42
RecName: 50S ribosomal protein L19
Begin-End: 2-112
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
NTLDFVDQASLRDDIPTFSPGDTVNVHVKVIEGSKERIQVFKGVVIRRQGGGISETFTVR
KESYGVGVERTFPVHSPNIDHIDVLTRGDVRRAKLYYLRELRGKKAKIKEK
Structures of the domain A0QV42 2-112
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xym X-ray 3.08 P 4-112 None
5o60 X-ray 3.2 Q 4-112 None


© NPIDB team 2003 - 2019

text