Pfam domain
Pfam family: Ribosomal_S15 (PF00312.21)
Uniprot AC: A0QVQ3
RecName: 30S ribosomal protein S15
Begin-End: 8-88
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
KKEILGQYGLHDTDTGSPEAQVALLTKRIQDLTEHLKVHKHDHHSRRGLLLLVGRRRRLL
KYVAQVDVARYRSLIERLGLR
Structures of the domain A0QVQ3 8-88
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyu X-ray 3.45 O 8-87 None
5o5j X-ray 3.45 O 8-88 None


© NPIDB team 2003 - 2019

text