Pfam domain
Pfam family: Sigma70_r2 (PF04542.13)
Uniprot AC: A0QW02
RecName: RNA polymerase sigma factor SigA
Begin-End: 233-303
Organism: Mycobacterium smegmatis
Interaction Mode:  H-Bb H-Mj H-Mn 

Sequence:
LLEANLRLVVSLAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQA
ITRAMADQART
Structures of the domain A0QW02 233-303
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5tw1 X-ray 2.76 F 233-302  H-Bb H-Mj H-Mn 
5vi5 X-ray 3.2 F 233-302  H-Bb H-Mj H-Mn 


© NPIDB team 2003 - 2019

text