Pfam domain
Pfam family: Sigma70_r3 (PF04539.18)
Uniprot AC: A0QW02
RecName: RNA polymerase sigma factor SigA
Begin-End: 312-389
Organism: Mycobacterium smegmatis
Interaction Mode:  H-Bb H-Mj 

Sequence:
EVINKLGRIQRELLQDLGREPTPEELAKEMDITPEKVLEIQQYAREPISLDQTIGDEGDS
QLGDFIEDSEAVVAVDAV
Structures of the domain A0QW02 312-389
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dcf X-ray 3.45 F 312-389  H-Bb H-Mj 
6ccv X-ray 3.05 F 312-389  H-Bb H-Mj 
6vvt X-ray 2.9 F 312-389  H-Bb H-Mj 
5vi5 X-ray 3.2 F 312-389  H-Bb 
6cce X-ray 3.05 F 312-389  H-Bb H-Mj 
5vi8 X-ray 2.76 F 312-389  H-Bb H-Mj 
5tw1 X-ray 2.76 F 312-389  H-Bb H-Mj 
6vvs X-ray 3.11 F 312-389  H-Bb H-Mj 
6vvv X-ray 3.2 F 312-389  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text