Pfam domain
Pfam family: Sigma70_r3 (PF04539.15)
Uniprot AC: A0QW02
RecName: RNA polymerase sigma factor SigA
Begin-End: 312-389
Organism: Mycobacterium smegmatis
Interaction Mode:  H-Bb H-Mj 

Sequence:
EVINKLGRIQRELLQDLGREPTPEELAKEMDITPEKVLEIQQYAREPISLDQTIGDEGDS
QLGDFIEDSEAVVAVDAV
Structures of the domain A0QW02 312-389
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5tw1 X-ray 2.76 F 312-387  H-Bb H-Mj 
5vi5 X-ray 3.2 F 312-387  H-Bb 


© NPIDB team 2003 - 2019

text