Pfam domain
Pfam family: Sigma70_r4 (PF04545.15)
Uniprot AC: A0QW02
RecName: RNA polymerase sigma factor SigA
Begin-End: 401-454
Organism: Mycobacterium smegmatis
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
VLETLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRH
Structures of the domain A0QW02 401-454
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5tw1 X-ray 2.76 F 401-454  H-Bb H-Mj L-Bb L-Mj 
5vi5 X-ray 3.2 F 401-454  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text