Pfam domain
Pfam family: RNA_pol_Rpb6 (PF01192.21)
Uniprot AC: A0QWT1
RecName: DNA-directed RNA polymerase subunit omega
Begin-End: 39-102
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
ELLSRASSKYALVIYAAKRARQINDYYNQLGDGILEYVGPLVEPGLQEKPLSIALREIHG
DLLE
Structures of the domain A0QWT1 39-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5tw1 X-ray 2.76 E 39-100 None
5vi5 X-ray 3.2 E 39-100 None


© NPIDB team 2003 - 2019

text