Pfam domain
Pfam family: Ribosomal_L20 (PF00453.17)
Uniprot AC: A0QYU6
RecName: 50S ribosomal protein L20
Begin-End: 3-109
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
RVKRALNAQKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLTYAYRDRRARKGEFRKLWI
SRINAAARANDITYNRLIQGLKAAGVEVDRKNLAELAVSDPAAFTAL
Structures of the domain A0QYU6 3-109
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xym X-ray 3.08 Q 3-109 None
5o60 X-ray 3.2 R 3-109 None


© NPIDB team 2003 - 2019

text