Pfam domain
Pfam family: RbpA (PF13397.5)
Uniprot AC: A0QZ11
RecName: RNA polymerase-binding protein RbpA
Begin-End: 26-106
Organism: Mycobacterium smegmatis
Interaction Mode:  L-Bb 

Sequence:
PRQVARYRTDNGEEFDVPFADDAEIPGTWLCRNGLEGTLIEGDVPEPKKVKPPRTHWDML
LERRSVEELEELLKERLDLIK
Structures of the domain A0QZ11 26-106
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5tw1 X-ray 2.76 J 26-105  L-Bb 
5vi5 X-ray 3.2 J 26-105  L-Bb 


© NPIDB team 2003 - 2019

text