Pfam domain
Pfam family: RbpA (PF13397.8)
Uniprot AC: A0QZ11
RecName: RNA polymerase-binding protein RbpA
Begin-End: 26-106
Organism: Mycobacterium smegmatis
Interaction Mode:  L-Bb 

Sequence:
PRQVARYRTDNGEEFDVPFADDAEIPGTWLCRNGLEGTLIEGDVPEPKKVKPPRTHWDML
LERRSVEELEELLKERLDLIK
Structures of the domain A0QZ11 26-106
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dcf X-ray 3.45 J 25-106  L-Bb 
6ccv X-ray 3.05 J 26-106  L-Bb 
6vvt X-ray 2.9 J 26-106  L-Bb 
5vi5 X-ray 3.2 J 26-106  L-Bb 
5vi8 X-ray 2.76 J 26-106  L-Bb 
5tw1 X-ray 2.76 J 26-106  L-Bb 
6vvs X-ray 3.11 J 26-106  L-Bb 
6vvv X-ray 3.2 J 26-106  L-Bb 


© NPIDB team 2003 - 2021

text