Pfam domain
Pfam family: Ribosomal_L27 (PF01016.18)
Uniprot AC: A0R150
RecName: 50S ribosomal protein L27
Begin-End: 8-80
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
SSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTHFHPGVNVGRGGDDTLFALAPGAV
EFGAKRGRKTVNI
Structures of the domain A0R150 8-80
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xym X-ray 3.08 W 9-80 None
5o60 X-ray 3.2 X 9-80 None


© NPIDB team 2003 - 2019

text