Pfam domain
Pfam family: Ribosomal_L21p (PF00829.20)
Uniprot AC: A0R151
RecName: 50S ribosomal protein L21
Begin-End: 3-102
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
TYAIVKTGGKQYKVAAGDVVKVEKLDSEPGASVSLPVALVVDGANVTSKADDLAKVAVTA
EVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVTGI
Structures of the domain A0R151 3-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dzp X-ray 3.42 S 4-102 None
5o60 X-ray 3.2 S 4-102 None
5xym X-ray 3.08 R 4-102 None
5zet X-ray 3.2 S 4-102 None


© NPIDB team 2003 - 2021

text