Pfam domain
Pfam family: Ribosomal_L25p (PF01386.18)
Uniprot AC: A0R3D2
RecName: 50S ribosomal protein L25
Begin-End: 11-97
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
LTANVRTRTGKGASRQARRDGKVPAVLYGHGTDPQHLELNARDFAAVLRSHGTNAILTLD
IEGTEQLALTKALDVHPIRRNIQHADL
Structures of the domain A0R3D2 11-97
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dzp X-ray 3.42 W 11-97 None
5o60 X-ray 3.2 W 11-97 None
5xym X-ray 3.08 V 11-97 None
5zet X-ray 3.2 W 11-97 None


© NPIDB team 2003 - 2021

text