Pfam domain
Pfam family: Ribosomal_L32p (PF01783.22)
Uniprot AC: A0R3I9
RecName: 50S ribosomal protein L32
Begin-End: 2-50
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
AVPKRRMSRANTRSRRAQWKAEAPGLVTVSVAGQQRKVPRRLLKAARLG
Structures of the domain A0R3I9 2-50
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dzp X-ray 3.42 b 2-46 None
5o60 X-ray 3.2 b 1-45 None
5xym X-ray 3.08 0 2-46 None
5zet X-ray 3.2 3 2-46 None


© NPIDB team 2003 - 2021

text