Pfam domain
Pfam family: Ribosomal_L33 (PF00471.19)
Uniprot AC: A0R551
RecName: 50S ribosomal protein L33 2
Begin-End: 8-52
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
PIVKLRSTAGTGYTYVTRKNRRNDPDRIVLRKYDPVLRRHVEFRE
Structures of the domain A0R551 8-52
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dzp X-ray 3.42 c 8-53 None
5xym X-ray 3.08 1 9-52 None


© NPIDB team 2003 - 2021

text