Pfam domain
Pfam family: Ribosomal_L9_N (PF01281.18)
Uniprot AC: A0R7F6
RecName: 50S ribosomal protein L9
Begin-End: 1-39
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
MKLILTAEVEHLGAAGDTVEVKDGYGRNYLLPRGLAIVA
Structures of the domain A0R7F6 1-39
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xym X-ray 3.08 H 1-39 None


© NPIDB team 2003 - 2021

text