Pfam domain
Pfam family: Ribosomal_S6 (PF01250.16)
Uniprot AC: A0R7F9
RecName: 30S ribosomal protein S6
Begin-End: 1-85
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
MVILDPTLDERTVAPSLETFLNVIRKDGGTVDKVDIWGRRRLAYEIAKHAEGIYAVIDVK
AEPATVSELDRQLNLNESVLRTKVL
Structures of the domain A0R7F9 1-85
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyu X-ray 3.45 F 10-84 None


© NPIDB team 2003 - 2019

text