Pfam domain
Pfam family: Ribosomal_L34 (PF00468.16)
Uniprot AC: A0R7K0
RecName: 50S ribosomal protein L34
Begin-End: 4-47
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
GKRTFQPNNRRRARVHGFRLRMRTRAGRAIVANRRSKGRRALTA
Structures of the domain A0R7K0 4-47
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dzp X-ray 3.42 d 5-47 None
5o60 X-ray 3.2 d 5-47 None
5xym X-ray 3.08 2 5-47 None
5zet X-ray 3.2 5 5-47 None


© NPIDB team 2003 - 2021

text