Pfam domain
Pfam family: Ribosomal_S9 (PF00380.18)
Uniprot AC: A2D919
RecName: 40S ribosomal protein S16, putative
Begin-End: 8-140
Organism: Trichomonas vaginalis
Interaction Mode:   

Sequence:
GRKKTATAVAYCCEGSGLIKLNGTPINMVSSETLRAKILEPLQLIGEESWGNLDIRVRVH
GGGHVAQVYAIRQAVAKAIVAYYQKYVDEATKTEIKNTLLGYDRTLLVADPRRMEPKKFG
GQGARVRRQMSYR
Structures of the domain A2D919 8-140
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyi X-ray 3.35 Q 8-140 None


© NPIDB team 2003 - 2019

text