Pfam domain
Pfam family: Myb_DNA-binding (PF00249.30)
Uniprot AC: A2D9X4
RecName: MYB3
Begin-End: 53-99
Organism: Trichomonas vaginalis
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
KGPFTEAEDDLIREYVKENGPQNWPRITSFLPNRSPKQCRERWFNHL
Structures of the domain A2D9X4 53-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3zqc X-ray 2.9 G 53-99  H-Bb H-Mj L-Bb 
3zqc X-ray 2.9 D 53-99  H-Bb H-Mj L-Bb 
3zqc X-ray 2.9 A 53-99  H-Bb H-Mj L-Bb 
3zqc X-ray 2.9 J 53-99  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2020

text