Pfam domain
Pfam family: KH_2 (PF07650.16)
Uniprot AC: A2DIM3
RecName: Ribosomal protein S3, putative
Begin-End: 21-97
Organism: Trichomonas vaginalis
Interaction Mode:   

Sequence:
ELNELLTRELTKEGYGGCEVRQTPTRTEIIIKAANTKEFVDNHGRRLQEVRMMIQKRWRL
KEDSLEIFIDRIQRKGL
Structures of the domain A2DIM3 21-97
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyi X-ray 3.35 D 21-90 None


© NPIDB team 2003 - 2019

text