Pfam domain
Pfam family: Ribosomal_S4 (PF00163.18)
Uniprot AC: A2DNY3
RecName: Uncharacterized protein
Begin-End: 5-93
Organism: Trichomonas vaginalis
Interaction Mode:   

Sequence:
NFSRTFKKPMRPYEKERMHKELQVVGEYGLKNKREIWRVSYTLSKIRHAARELLTLPEND
SKRIFEGAALLRRLTKLGVLDESKQKLDY
Structures of the domain A2DNY3 5-93
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyi X-ray 3.35 J 11-60 None


© NPIDB team 2003 - 2019

text