Pfam domain
Pfam family: Ribosomal_S17e (PF00833.17)
Uniprot AC: A2DPS3
RecName: 40S ribosomal protein S17-B, putative
Begin-End: 3-120
Organism: Trichomonas vaginalis
Interaction Mode:   

Sequence:
RIRTKTTKRAARLVIERFYGQLSFDFQDNKRVCDAVADIPSKRMRNKIAGYVTHLMRRLE
RGPVRGISFKLQEQEREKRDNWMPTTSKLNVPKILVDPETKEMLAAIGLGEMEGVEVF
Structures of the domain A2DPS3 3-120
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyi X-ray 3.35 R 3-119 None


© NPIDB team 2003 - 2019

text