Pfam domain
Pfam family: V-set (PF07686.16)
Uniprot AC: A2NHM3
RecName: If kappa light chain (Fragment)
Begin-End: 6-112
Organism: Mus musculus
Interaction Mode:   

Sequence:
QTPLSLPVSLGDQASISCRSSQSIVHTNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPD
RFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPRTFGGGTKLEIK
Structures of the domain A2NHM3 6-112
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ok0 X-ray 1.89 L 6-106 None
1cbv X-ray 2.66 L 6-110 None


© NPIDB team 2003 - 2019

text